SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD022045 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD022045
Domain Number 1 Region: 274-317
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000048
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 105-165
Classification Level Classification E-value
Superfamily PH domain-like 0.0000122
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 
Domain Number 3 Region: 25-70
Classification Level Classification E-value
Superfamily PLP-binding barrel 0.0000942
Family Alanine racemase-like, N-terminal domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD022045
Sequence length 833
Comment 833
Sequence
MPRPLHDTSTALNAANLLALPQRFGCPVWAYDADIISQRIAQLRHFDTIRFAQKACSNIH
ILRLMREQGVKERGGGGGGGGGSSASPKVVRAVPKVETSEDTSGGVQKFRVKLLPEGAGS
PMDVLCQVGLDGIRMLDPNTSRTLRIYPLETVTRWDVLDSSIFAFWSKSSVDFEARRIRL
KSNSYTTNTILDTVTAASVQFKEMGGSSISRSRAIADAAKPPEQQNDRRKNFLDWRNLMK
PMNEEKDHWYFNKIERQKLISCDLNFVMAIMKKVPDEAVTKCTACTADFSAFNRRHHCRN
CGDIFCDKCTQGRTPLTTDADAQPAEVSQRLNNAREAANRPIVHSHEDLAKKLKDAMDIN
KKSSSASSRSTDGSSRRMREVACPTCTVHLQVQVPTSGSETIECGVCQQPFLESRKLKPL
AVAILDWRLRQQETRQREEKCGRNLMGMGMEAAWACAVDRATGAADSTKRFFLSFRRPPP
PPPGPNPIDILKRLQRQAFYDIMQLREKQEKIERVLTLFKASKSGPFAEESTRVKGIITV
AGSLSSKNKKDSGPDSSETNSGISSQFVFQTNVRKKDSLLAELVTDHRSLPSENDSIGSP
FVLSKVMYLANINDSLSASAVPVGARCDDFSTDPSLQEEHWLASFRSSLRPPLLIKRHNY
AAGLILRSKNFAVSLAELISAAGKPNNSGEASRFFTGFGQMSCQMQNEMKLTMSAALHGP
GLISRKSKPTAGGCVDFDLKIDEDSRVGAWIEVKKANPRLVRWALTLSETPEDDLGWGLS
LRRGTEGSPERLQLEGFLNVHLGKKATLQPGLMFNIDGRRCAPALVFQSSWFL
Download sequence
Identical sequences OsIBCD022045 39946.BGIOSIBCE023330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]