SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD024464 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024464
Domain Number 1 Region: 194-387
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.47e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00066
Further Details:      
 
Domain Number 2 Region: 27-145
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-18
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Weak hits

Sequence:  OsIBCD024464
Domain Number - Region: 687-747
Classification Level Classification E-value
Superfamily AF1862-like 0.0876
Family Cas Cmr5-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024464
Sequence length 870
Comment 870
Sequence
MAAATAPVAGAAERQQQQQQRGGAASASGNAVFKSGPLFISSKGIGWKSWKKRWFILTRT
SLVFFKSDPNTLPQRGGEVNVTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKA
ETSEDLFEWKTALEEALAQAPNAALVMGHNGIFRNDTTDPYEGAVPNWREKRPIKSLVVG
RPILLALEDIDGSPSFLEKALRFLERHGIKVEGILRQAADVEEVDKRMQEYEQGRTEFAQ
DEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAFRLESKESRINSMRAAISETFPEPNR
RLLQRILRMMHTVASHTAENRMTASAVAACMAPLLLRPLLAGECEMEDDLDMNGDSSAQL
IAAANAANSAQGIVTTLLEEYEGIFYDEHLRCSLSPDSQIEDSGSEESTDDETVDIKDSG
FHDAENDADQELDDSERILSGKLSETSACTAGDLYDYKVADDDDSDGEPSTEDKALETKV
DVNDAQHSHLAENVSVNVQRSSNEKDPPNMVSSQDSPLSMGDILSSLDAGISLPGPGPEY
SVDRQSIKSNGTQMHVKRSNFWGRNNGRKSQQSELADSSGEEELAIQRLEITKNDLQIRI
AKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMSSAQI
SSSRSMDSKTKAELEEIALAEADVARLKQKVAELHLQLNQQRQHQYGSLADANDRYQHLP
NHLPQNFVQSGFDMNLAFCNQEKKQRNEGPAGASHWRSIKQHVLPHGSSRPFSRKHSMDA
SSSDSREASTSMPADGNSMSVNIPKATEGVEYGRQAPVASSTLVELTTRLDFFKERRSQL
MEQLHSLDLGNGSANHGFPYKSSSPWNSPR
Download sequence
Identical sequences B8B5I6
39946.BGIOSIBCE025901 OsIBCD024464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]