SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD026113 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD026113
Domain Number 1 Region: 126-172
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000000379
Family BSD domain 0.0028
Further Details:      
 
Weak hits

Sequence:  OsIBCD026113
Domain Number - Region: 19-102
Classification Level Classification E-value
Superfamily PH domain-like 0.00197
Family TFIIH domain 0.038
Further Details:      
 
Domain Number - Region: 237-258
Classification Level Classification E-value
Superfamily BSD domain-like 0.00575
Family BSD domain 0.014
Further Details:      
 
Domain Number - Region: 470-518
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.0824
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD026113
Sequence length 545
Comment 545
Sequence
MGSMTIGAKYKTTLKDPGTTGVLRMNEDKFTFTPHDPRSAMKLNVDFRSIKGHKFNKVDG
SKPAPPLLNLSKDSDKGGGYMFEFDNVTNRDLSRDFVAKVLGKQQGTIPPKPNVPPENSV
TSTGEEQLSAAEMQRRMKLLQEDSELQKLHMKFVLGNILQESEFWATRKNLLEDEANKGS
KQRPGFKSAMLADVRPSADGRTFTLVIAGDIDVISFFFLLLSQTNKVTFSLTTEIIHQMS
EKDFWTKYFRAEYLLRTKNTVAATAEAAEDEELAIFLKNDDILAKEARLKIKRVDPTLDM
EADAGDDYIHLPDHGIIRDGSKETIDNDGELARRTLSQDLNRHAAVVLEGRSSDVELTDT
KTVAEAIARSKKAAEPPSSSISDDTNHERLVKVARMTEIEDLQAPRSLPYAPLCIKDPRE
YFDSQQANALRSLGGNNDGRHARNCRLSTDDAFDHLLGQISSIKVNGLNYPVIQSDVALK
VQRIKDAMTQIYQKLQDIKESAQPDVRHEISQLVKPMTQALDAAFNHDLEQQQKSSKSGN
KPNGF
Download sequence
Identical sequences 39946.BGIOSIBCE027498 OsIBCD026113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]