SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD026644 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD026644
Domain Number 1 Region: 198-366
Classification Level Classification E-value
Superfamily Bet v1-like 7.69e-29
Family STAR domain 0.024
Further Details:      
 
Weak hits

Sequence:  OsIBCD026644
Domain Number - Region: 50-164
Classification Level Classification E-value
Superfamily PH domain-like 0.00484
Family Pleckstrin-homology domain (PH domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD026644
Sequence length 746
Comment 746
Sequence
MATITLKPPATAAAAGGEVSEVELSEAGSPDVGSQSSGSGGSGRSTAGSSGWVYHLGVNS
IGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIVGDASIDATAIENAASIGLDDDNRVIYSK
KLIVSAFGAVLGCRFSLVLLIACGDPGEARKWVEAFEQAKQQSQKILSGGPEKLLRQSSN
LQSHEIINTNFGGDSGDAFEAHEWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANP
DTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSR
QWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLE
MSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAANPALTSDLPSTVVKPKQSDSLI
IQSELDDSELNDEFYDALARGESFEDEDSDDDDDMIPKAGKVKFKNISWAIAGLAMKPTK
GHNRKHKRHFNSSSTASVEKSELVTNSTPVTIDSNHFHGTLRRAKSENDPNSWSEPGGEK
FMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHPKSLVQSEAAKKIPFILV
INLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDARFKLIPSIVEGYWMVKRA
VGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTGLVVDLAILIEAK
EEKELPEYILGTVRLNRANPDSAVPI
Download sequence
Identical sequences OsIBCD026644 39946.BGIOSIBCE027992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]