SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD030939 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD030939
Domain Number - Region: 191-259
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0889
Family Tetracyclin repressor-like, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030939
Sequence length 262
Comment 262
Sequence
MASDHRRHTGVVVYGKEYFFGGGIQKDHPGRTPYGTPVRVEDLGVTHVPREIFEDFLQDI
SPRYTPATYNLLSNNCNNFTNEAAQFLVGSAIPSYILELPNEVMNSPFGALILPMIQGLE
TSLRAGVAPQPPQFKPSPVAAVTATQSPPSGSIHVEPKSTASDKTEVDNNGGGIPPAVQP
APVAAETSPAAVAEANMAPPPPVDPLREAKSRVQEEIKREFAAIMATGAVQAGEAAALAT
RRVMERHGLRRAAVAGGGMQRG
Download sequence
Identical sequences A0A0E0ITG9
OsIBCD030939 39946.BGIOSIBCE032445 ONIVA10G13140.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]