SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD030953 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030953
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-49
Family Necap1 N-terminal domain-like 0.0000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030953
Sequence length 287
Comment 287
Sequence
MAGVGVEEEEAFEHTLLVVREVSVYKIPPRTTSGGYKCGEWLQSDRIWSGRLRVVSCGDR
CEIRLEDPASGDLFAACFVLPGQREAAVETVLDSSRYFVLRIEDGRGKHAFVGLGFGERN
EAFDFNVALSDHEKYVKREHEKEAADGGAGGGEENDDGQIDIHPAVNRRLKEGETIRINV
KNKPSTGSGMLSSAGLSGGASAKPKASMLLAPPPGSAGKLRSPLPPPPNDPAAARMNSGS
NAGIRAPKEPAKRNSDAFSDLSAMKQNLPSSTESAQTKSTGAGWAAF
Download sequence
Identical sequences A0A0D3HEP2 A0A0E0ITY4 A0A0E0R0C3 A2Z8I3 Q9AUZ3
LOC_Os10g33630.1|PACid:21884658 LOC_Os10g33630.2|PACid:21884659 39946.BGIOSIBCE032460 39947.LOC_Os10g33630.1 LOC_Os10g33630.1|13110.m02962|protein LOC_Os10g33630.2|13110.m02963|protein OBART10G13110.1 OsIBCD030953 ONIVA10G14400.1 XP_015614217.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]