SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD031881 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031881
Domain Number 1 Region: 9-122
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-46
Family Dcp1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031881
Sequence length 332
Comment 332
Sequence
MDAEGTRLLNLTVLQRLDPAVEDILITAAHVTLYDFNIDLNQWSRKDVEGSLFVVKRNTQ
PRFQFIVMNRRNTDNLVEDLLSDFEYELQPPYLLYRNAAQEVNGIWFYNQHDCEAVASLF
GSEFEELEAVPTSAAIDGPLEPSPATTTIVSDAPDESLVNYFSSAASIGSVSNAPMAGRA
HPSSESVATPHVPLIIPSATPTHQIPPPLVGSSAPPLPLHDTNVHTARSANLVTPAFFTP
PSSSSTSMVPPASSMMPTAPPLHPTSASAQRATYGTPLLQPFPPPTPPPSLTPSYNEGPI
ISRDKVKEALLRLVQNDQFIDLVYRELQNAHM
Download sequence
Identical sequences B8BJ62
OsIBCD031881 39946.BGIOSIBCE033540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]