SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD037942 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD037942
Domain Number - Region: 46-109
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0434
Family Tetracyclin repressor-like, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037942
Sequence length 279
Comment 279
Sequence
MLATTRLPPPPAAAAATATPTPPARGGGGVEFRRKLHFLSSELHLDPFPLLALHPPLRSA
PLPQLRGSLALLLSHGLSAGDAARVYSAFPSLLTSPPGEHLRFLSADAPLPPPLLRAAVV
RSPRLLAASVPGTLRPALRFLRRRVALRRRPLPLAAALLLAFSVDRTLLPKVLFLRDATG
MPDPAVCAILRRAPAILSYGIETNLTPKLRFLADRMGRDPAVELAEFPHYFAFSLEGRIR
PRHEALKERRVQMSLKDMLTISDDEFRERLVDAALSAPR
Download sequence
Identical sequences A2X6F2
39946.BGIOSIBCE007549 OsIBCD037942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]