SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD042026 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD042026
Domain Number - Region: 140-190
Classification Level Classification E-value
Superfamily PH domain-like 0.00963
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD042026
Sequence length 218
Comment 218
Sequence
MDLTKSSSNTASLKKLQDDGALPVRGTMEREAGGTKPKPILGRMVVIEDYISCGFLPPPS
EFLLLVLNFYGLSLLHLNPNSVAFLSIFAHLCEADIGVAPFLDLFRFYYELRWMESNRVS
GCTGFRLRDGLKLRYVPFQCPSSRSKWRTRWFYLRIEKSDPVLVVPKDQPDKLPEWTAKP
ALSPSLQSFVDIIDDLRERGLSGYEVAADFIGRRIQPL
Download sequence
Identical sequences OsIBCD042026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]