SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD042980 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD042980
Domain Number - Region: 44-70
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00196
Family H-NS histone-like proteins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD042980
Sequence length 105
Comment 105
Sequence
MWLTTVALLLTTVVIWTALQKRKRGEACPAAVAPPPIVQGTALVRFLRAMARDGPLEVIR
EQLAKLGSVFMASAPLGLFKVTFLVGAELGFLIDGVTAKPALTKK
Download sequence
Identical sequences A0A0D3GQQ3 A2YL27 Q8H3B5
OsIBCD042980 LOC_Os07g28140.1|13107.m02813|protein LOC_Os07g28140.1|PACid:21897956 OBART07G13560.1 39946.BGIOSIBCE024683 39947.LOC_Os07g28140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]