SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD047188 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047188
Domain Number 1 Region: 199-307
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.34e-27
Family Hypothetical protein At5g48480 0.048
Further Details:      
 
Domain Number 2 Region: 788-897
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.74e-20
Family Tetracyclin repressor-like, C-terminal domain 0.00072
Further Details:      
 
Domain Number 3 Region: 716-776
Classification Level Classification E-value
Superfamily Homeodomain-like 3.75e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047188
Sequence length 899
Comment 899
Sequence
MASLHRHPAPALRSLVASVWAHDPVPVVGRPHAREHVLPTGATHLAVRVGGEPLRVFDHA
ADLRGHCLGHAVVGGARTAYHVRDVAQPAISVGAMLRPGAAAVLLGVPESALAGHHTSLE
LLLPAGEVDALLARLHACADAPARLSVFERWLADRATGRPPLLHPALRAVFQRSWHPDAW
VETWRPIPPRRGMCRAERSAAMDFYARAFGARELFRLTEPDGRIGHAEVDLGGHTLMLSE
EYPDMGVRSPEHLGATPVTLHLHVDDADALVARAVAEGGTLERGMQDHFYGERSGTVRDP
FGHRWLIGHAIESVTPQEMQRRYTALDGTRPIRPSSEPRAMRPSGEDTCGDARHGIGHAD
HAPRDPVAVPGPGVEPAGIVIAQSLLQRSCQCHGVLYAGVHPLATGGAVHMGSIAAEQHA
PAADLRRHAVLQLEAGAPGHFLHAPAGRRDAACGEQCFHHVLGGRACRAGHCGDHAIAIP
RFSLRCGQRSHHHQAFGCKEQAHFGALQRPRHPHVGQHESLGIVSAHEIDAGLLPHHAVG
SIASHDPSRLHVLHAAIRPRQRGADAIAGFRERQQPRGAPHAAAPVADPARQDRFGDVLR
AHQGIRIAGWQALEADVEEHLAGFAHAEVRGLHAGSDQVRHHAQWLEHFQGAGMDDGRAR
GVQPRRMSVDQQRGDPEPVQCQPQCHAGRTGPHDEHFRDNRSIGCCVHGDLQSTPLTRSQ
ATKDRILDAARTLFASQGYDGTTVREVAALAQANPALVIRYYGSKEALFLAAAEFDLQLP
DLAGVSRDGLGERLAAHFFTVWEDSPSGRQLVALLRAAATHADARARMQDIFERQLRAAV
RRLTAPAADADVRAALIASQMLGFALVRYVLEFSARGMSRKMAVRALGATLQRYLVEPI
Download sequence
Identical sequences OsIBSD047188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]