SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD047608 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047608
Domain Number 1 Region: 190-422
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.41e-47
Family ABC transporter ATPase domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 1-192
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 3.79e-37
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047608
Sequence length 445
Comment 445
Sequence
MAVLIGSMLTVSGTSLQGLFKNPLATGDLIGLTSGATLLAAIAIVLGGHFKEYLPEAIQF
SLVGIAAFIGSFLSMMLVYRISTSGGKTNVVMMLLTGVAITAIGFSITGFLIYISKDEQL
RDLTFWNLGSLAAATWTKNIILAIVITIAYIILLPKGKALNAMMLGEKDAQHLGINVERL
KKQIIITVALMAHQINYQHKEFRILDGVNVSLEYGEFLAIVGPNGAGKSSLLSVLADEVK
SGNNKVLFKDKPIRKWNIRELSKHKAKFSQHNSNDIPLEVKDVIMMGRYPYFDAQPGKED
LEAMNNMMYETDIFHLKEREYNTLSGGEKQRVHLSRVMAQLENEIAHKLVFLDEPLNNLD
IKHQYKALEIIKNFTKKANSAIVVLHDLNLAAQFADKILLMKSGQVSAYGTPQEVFTEEN
ISNAYNFPCTICGHPITNNPMIIFG
Download sequence
Identical sequences OsIBSD047608 39946.BGIOSIBSE038500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]