SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD047820 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047820
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily L-aspartase-like 1.26e-44
Family L-aspartase/fumarase 0.000000395
Further Details:      
 
Domain Number 2 Region: 600-713
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 1.31e-41
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.0000108
Further Details:      
 
Domain Number 3 Region: 1022-1139
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.63e-23
Family Thioltransferase 0.0000286
Further Details:      
 
Domain Number 4 Region: 1126-1188
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000298
Family Tetracyclin repressor-like, N-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  OsIBSD047820
Domain Number - Region: 1196-1279
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00023
Family Tetracyclin repressor-like, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047820
Sequence length 1313
Comment 1313
Sequence
MGRTQLQDAVPMTLGQEFHAFSVLLNEETRNLHRTAELLLEVNLGATAIGTALNTPEGYQ
PLAVQKLAEVSGLPVVPAEDLIEATSDCGAYVMVHSALKRLAVKLSKICNDLRLLSSGPR
AGLNEINLPELQAGSSIMPDQSRTRWCRKWSIRRQERKSPGAYSRARLGGIGIGFAGGLG
VLVLALIGVKPGSIPFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILA
PIVTYFLTIFAGTGNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVV
YMSSVMEGHGVSYLHLLMVVIPSTFCAVLVMSLLVTWLFDSKLSNDPVYLKRLEEGLITL
RGNNALAIKPRAKTSVLLFLLGVLCVVAYAIINSPGLGLVAKPLMNTTNAILIIMLSVAT
LTTLLCRVDTDMVLNSSTFKAGMSACICILGVAWLGDTFVQANIDWIKETAGSVIQAHPW
LLAVIFFFCSALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAV
QMDDTGTTRIGRFVFNHPFFIPGTMGVIFAVVFGFLLGSVMLLCFLPQAAQASLFAPKGG
SQFVPVDQAFAFDFKQQGGQVTLNWQIRPGYYLYRQQIKLVPQQATLGAFTLPEGLSHKD
EFFGEVAIFKQQLNLQVPLQQAAANASLSVTYQGCAEAGFCYPPETRTIPLDAVSATAAA
PLPAAASEPAEQSATPASLPFSPLWALLIGIGIAFTPCVLPMYPLISGIILGRDRPQSSG
RILALALVYVQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSALFIALALSMFGLYS
LQLPSALQTRLASWSNTQRGGSLTGVFLMGALAGLICSPCTTAPLSAILLYIAQSGNLWA
GGGTLYLYALGMGIPLVIVTLFGNRLLPRSGPWMQYVKEAFGFVILALPVFLLERVIGDL
WGLRLWSLLGLAFFGWAFALSLRSARGWARALQLLLLAAAVIAARPLQDWAFGADQAQQA
AQPHLAFTRINNVEQLDLALQQARGKPVMLDLYADWCVACKEFEKYTFSDAAVQASLANA
VLLQADVTANGAEQATLLKHLQVLGLPTILFFDPAGRELTAERVTGFMKAEAFNAHLQKG
LATATLEMLAEKLDVQPGDLKRFWPDREALLYDCLRYHGQQIDTWRRQLLLDENLSPQQK
LLARYDVLAEYVQQDRYPGCLFIAACSFFPETDHPIHQLAEQQKLTSLELTRELLRDMDA
DDADMVAQQMELIQEGCLSKLLVKRQLQDVSVAKRLAEDILQVAQCRRNGALS
Download sequence
Identical sequences 39946.BGIOSIBSE038127 OsIBSD047820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]