SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD048009 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048009
Domain Number 1 Region: 488-810
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 5.98e-127
Family HemS/ChuS-like 0.000000000309
Further Details:      
 
Domain Number 2 Region: 1040-1356
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 7.06e-83
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00000159
Further Details:      
 
Domain Number 3 Region: 3-486
Classification Level Classification E-value
Superfamily Porins 7.1e-63
Family Ligand-gated protein channel 0.0042
Further Details:      
 
Domain Number 4 Region: 1355-1561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.29e-49
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 
Domain Number 5 Region: 810-1056
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 2.08e-48
Family TroA-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048009
Sequence length 1589
Comment 1589
Sequence
MGASAYGKTDNLDGLLSFGTRDVGNLRQGNGFDAPNDETINNVLAKGTWKIDDNQSLGGN
LRYYNNSAQEPKNPQTPASSAGNLMTDRSTIQRDAALSYKLKPVGQDWLDAEAKVYYSDV
KINAHASGSEDEARKQTTKGAKLENRTRLFADTFASHLLTYGTEAYKQEQTPGGATESFP
HAKINFASGWLQDEITLRDLPVTLLAGTRYDNYKGSSDGYADVDANKWSSRGAVSITPTD
WLMLFGSYSQAFRAPTMGEMYNDSKHFSIPMGPTTITNYWVPNPNLKPETNETQEYGFGL
RFDDLLLADDSLQFKASYFDTKAKDYITTDVTMELGRGPRGPYCISCTTFSTNIDRAKIW
GWDATLSYKTSWFGWDLAYNRTRGKNEATGDWLSSINPDTVTSSLDVPLGETGLSAGWVA
TFAERATRVQTGTPEQGGYGVNDFYLSYKGRDRLQGVTTTVVLGNAFDKEYYSPQGVPQD
GRNAKLLAKIDHPGKYARDLAAILGVSEAELTHARVGHDARRLQADARTLLTELEQVGVT
KSITRNSYAVHEQMGRYRNQHLNGHAGLILNPRELDLRLFLNHWTSVFAMSETNKRGVRH
SIQFFDPQGDALHKIYTTEETDLPAWMALVERHRSEENPALALQPAEAATSDEATQDQAK
IDAEWRAMTDVHQFFQLLSRNKLTRQQAFRAVGDDLAYQVDNSALSQLLEAAQQQQNEIM
IFVGNRGCVQIFTGQIERLMPQEGWINVFNRRFTLHLIENAIAESWITRKPTKDGIVTSL
ELFAADGTQIAQLYGQRTEGQPEQTQWREQRIVSIGGDVTEIAFALGAGDDVIARDSTSL
HPEAVKKLPDVGYMRQLNAEGILALKPTLVLTTELAQPALVLKQLADSGVKVVSVPGDTT
LQAVPKKIAAIAAALQRDEQGKQLSERYQQQLAAVDTTPLPVKVLFVMSHGGITPMAAGQ
HTAADAVIAAAGLKNAMQGFDRYRPLSQEGVIASAPDLLLVTTDGVRTLGGEQQLWTLPG
LALTPAGKQRRVLIVDDMTLLGFAIIGLLVLLTLLALVAANLGALTLSFGTLWREPFSDA
AWHIWLNIRLPRVLLAVVIGCALAVSGAVMQGLFRNPLADPSLLGISSGGALFVALFIVM
PLALPVTIALYGHMLAAFLGSLLVSLLIYGISRSGHGNLSRLLLAGIAINALCMAAIGVL
SYISSDQQLRQFSLWMMGSLSQSQWPTLAVSASLILPTVLLTLLQARRLNLLQLGDEEAH
YLGVNVQRAKLQLLLLSALLIGAAVAMSGVIGFVGLVVPHLVRMRLGGDHRWLLPCSALG
GACLLLVSDTLARTLVAPAEMPVGLMTSLIGGPYFFLAGGEMVAIIGPNGAGKSTLLRLL
TGYLTPDCGECRLLGRPLEHWAPQQLAKVRAVMRQYSDLAFPFSVEEVVSMGRAPHGKRD
EHQAIQQVMAQTDCLALAQRDYRQLSGGEQQRVQLARVLAQLWQPQPSPAWLFLDEPTSA
LDLYHQQHTLRLLRSLTRQQPLGVCCVLHDLNLAALYADRILLLHQGRLVASGTPQEVLQ
TEILTRWYQADLGVIHHPEVSLPQVYLRQ
Download sequence
Identical sequences OsIBSD048009 39946.BGIOSIBSE038103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]