SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD048649 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048649
Domain Number 1 Region: 397-649
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 5.89e-75
Family TroA-like 0.0000167
Further Details:      
 
Domain Number 2 Region: 3-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-42
Family ABC transporter ATPase domain-like 0.00092
Further Details:      
 
Domain Number 3 Region: 214-397
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.000000000209
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048649
Sequence length 650
Comment 650
Sequence
MILMNELVAGYDRQPVTRPLSGTIERGSMTAIVGANGCGKSTLLKTLAGFIPPVGGSFRW
QGKRPVIGWLAQRHALEAQFPLTVQDVVSMGCWPGISLLSGFRRETRLRIASALERVGLA
SMALSTIDELSGGQFQRMLFARVLVQQAPLVMLDEPFTGVDEATCNVLMDLMLEMYMQGQ
TLLAVLHDSERVARHFPQTLMLDADIPHWKTERLRRMSLMGDALSHAILPGVAVGYLLSG
MSLLAMSIGGFIAGITVALVAGLVSRRTPLKEDASFAGFYLGSLALGVTLVSLRGSNVDL
LHLLFGSILAVDNDAALFVTGVCMFTLITLAIFYRGLVTEAFDTAWLQVNARGLPGLLHG
LFLALLVLNLVAGFQVLGTLMAVGLMMLPAVAARCWEVGGDHVNVTTLVGPDGDPHTFEP
SPKDSAALSKADVVVVNGLGLEGWLDRLVKASGFKGQLVVASTGVKTHTLEEDGKTVTDP
HAWNSAANGALYAQNILNGLVKADPEDKAALEASGQPYIAQLTQLDGWAKTRFSQIPQEK
RNVLTSHDALGYFSRAYGVTFMAPQGLSSESEASAAQVAEIINQIKADGVKTWFMENQLD
PRLVKQIATATGAQPGGELYPEALSAKGGVADTYVKAFRHNVNTLADSMK
Download sequence
Identical sequences OsIBSD048649 39946.BGIOSIBSE038515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]