SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD048860 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048860
Domain Number 1 Region: 74-206
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 7e-33
Family Tetracyclin repressor-like, C-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 9-71
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000014
Family Tetracyclin repressor-like, N-terminal domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048860
Sequence length 213
Comment 213
Sequence
MSEKNTATRLTRETVLRGALALLNDIGIDALSTRRLAQHLGVQSPTLYWHFKNKAELLKA
MAETIMLDHREEVPADMPWQDWVVTNAGNFRRALLAYRDGARLHAGTRPQEPQFAVIEAK
VALLCRAGLTPERAVNLLFAVGRFVVGWVLEEQQMQPDDPLNDADRRRYPLLCQGWETLQ
EKGADALFEAGVRLLVDGAEAGLAIDNNHGRQS
Download sequence
Identical sequences A0A2G4QFL7
OsIBSD048860 WP_033643144.1.12767 WP_033643144.1.16816 WP_033643144.1.55230 WP_033643144.1.56175 WP_033643144.1.89943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]