SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD049213 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBSD049213
Domain Number - Region: 59-82
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0373
Family H-NS histone-like proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD049213
Sequence length 98
Comment 98
Sequence
MARRLAGREPEIKGRGRRTSGRFGSGESKQRASWRGPDPTTARHRLIDQAASVALAVKGE
EDWRQQWHGRGHRPHQHQRLLVEHHHRLFRLGLGQRDR
Download sequence
Identical sequences 39946.BGIOSIBSE038852 OsIBSD049213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]