SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD003029 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD003029
Domain Number 1 Region: 221-607
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.23e-95
Family Regulator of chromosome condensation RCC1 0.00027
Further Details:      
 
Domain Number 2 Region: 7-119
Classification Level Classification E-value
Superfamily PH domain-like 6.01e-21
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 3 Region: 606-652
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000331
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003029
Sequence length 854
Comment 854
Sequence
MFNILKALITLKKGTKLIKYSRRGKPKIRAFRLSSVSDKPQDETSLIWFSHKKEKFLRLS
SVTKIIPGQRTAVFGRFLHPEKDYLSFSLIFKNGQRSLDLVCKDQAEVEVWFSALEGLIS
SFRKKSLINEHKDRVSFSEEVTYYQDRHSYDSTLDIASNISLSFNSAGYCGTNSFSFRKS
DVGFDRLNMIRTSAADSSRVSISSALSSYSQGSGTDDIESLGDVYVWGEVWTDVTPSDGH
TSSSCSKVDVLIPKPLESDVVLDVNQIACGTRHVALTTRQGEVFTWGEEFGGRLGHGTDA
DISRPKLVESLSLTVVDLISCGEFHTCAVTTSGDLFNWGDGSYNVGLLGCGTEVSYWLPK
KVSGPLEGLQVLSVACGSWHSALTTSSGKLYTFGDGTFGVLGHGDRETLAYPKEVEALSG
FKTIKVACGIWHSAAIVEVTNQTGANVMSKKLYTWGDGDKNRLGHGDKEPRLVPKCVQAL
LEYDFHQLACGHNMTVALATSGRVFTMGSSSNGQLGNPKSDGKQPCLVQDRLASELVEEI
SCGASHVTVLTSRSEVYTWGMGANGRLGHGDLKDRKKPCLVEALKDRHVKSISCGSNFTT
CICIHKWVSGADQSVCTGCRQAFGFTRKRHDCYNCGLVHCHACSSRKVLKAALAPTPGKP
HRLNGIVHELPSDAAESLKALQNQVQALLREQRSHPSELLNPMDHDGIQLSSGGNALHDF
SNHRSGSTRYLFMSQDASSASGSAISITSEPPSHRGMEHHAKVPNDFVPKHDTHGEVQLI
EQFEPGVYVTLIQLKDGSKVFKRVRFSKKKFAENQAEEWWRENQERVFKKYSHPTVPQTT
STKTGSSNEEEHHS
Download sequence
Identical sequences OsIBCD003029 39946.BGIOSIBCE003306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]