SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD003168 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD003168
Domain Number 1 Region: 13-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-17
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD003168
Sequence length 703
Comment 703
Sequence
MALTAKEIPQGFLIHIPEVDHSTFDASLPSSAKGTLQNSEGKTWPVELEKLDGHVFLTTG
WAKFVEDNSLREYEFLLFRYDDNMHFMVLPFGLNACEKVIRSSGSPQGKLPCDIFCCTKR
GRDGDRLTEAANSLTPSHSQVLQRTTQGHELISPQSFPDQHEVCGSKDGLDEHLSLNGPM
EDDKANAIAEVMSILDVDKVTVELFCAMLVFYKWNVDAVAEDFDICRGKPQIQNLFLKHK
LHFQFDIVKRKLRKFFPPDDYYSSPILESRKCSLEEPKLSNQPLQCDLTTEKCRLVDEHD
LCNFSQKKRRKRGSFCSPETPRRSPRLARQNNSHDSAENTLKERSEERQPSPDSMIDQAE
SRSEQACLCHDKTDSGSLFQDSKKVKPAHGEVDLCEEPQHNQGENEGNLDQVNNKETDEE
QIERNAVETSESFTRRGCIKSSPASCEVPACLRINELSLTWKPAEHVNPLEKVLLDIQRD
NFMKTISHVQGIIRNHPSDLLTADVITVVVQKEIFKWNCCLKDRDAQRIVNALLEHARKI
KEMHNFNSEMRKEEFSAKLKVHLKWQLKEVETIYTSLELDYKKATSDDNIAFSMLHDKKK
KLHNLQDEITGLQQSLEMKKDEMQKLAHQVAEHESVFQKSLMERLRIKEVMKGYEQTLAE
VKVQLTSTEVGSIDIEALVKVEMDNMTKEIELSKESLLNITFH
Download sequence
Identical sequences A2WUM3 A2ZXE3
39946.BGIOSIBCE003467 OsIBCD003168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]