SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD004532 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004532
Domain Number 1 Region: 268-658
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.81e-98
Family Regulator of chromosome condensation RCC1 0.00077
Further Details:      
 
Domain Number 2 Region: 20-128
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-26
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 657-727
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004532
Sequence length 1124
Comment 1124
Sequence
MSDASSDLAGGRAAPPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWF
SGKEEKHLRLSQVSRIVPGQRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVW
FAGLKTLISHSHQRKWRTESRSDIISSGATSPRTYTRRSSPLSSPFSSNDSVHKDGSDHY
RLRSPFGSPPKNALDKAFSDVVLYAVPPKGFFPSDSNAGSVHSMSSGHSDNTNGHPRGIP
MDAFRVSYSSAISSSSHGSGHDDGDALGDVFIWGEGTGEGILGGGSSRVGSSSSAKMDYL
VPKPLEFAVRLDVQNISCGGRHAALVTKQGEIYSWGEESGGRLGHGVDCDVAQPKLIDSL
AHMNIELVACGEYHTCAVTLSGDLYTWGDGTFKFGLLGHGNDVSHWVPKRVDGPLEGIHV
SSISCGPWHTALVTSAGQLFTFGDGSFGVLGHGDRASLSVPREVESLKGLRTVRAACGVW
HTAAVVEVMVGNSSSSNCSSGKIFTWGDGDKGRLGHGDKDSRFVPTCVAALVEPNFCQVA
CGHCLTVALTTSGHVYTMGSAVYGQLGNPQADGLLPVRVEGKLHKNFVEEISCGAYHVAV
LTSRTEVYTWGKGANGRLGHGGTDDKNTPTLVEALKDKQVRSVVCGINFTAAICIHKWVS
GSDQSMCSGCRQPFNLRRKRHNCYNCALVFCHSCSSKKSLKASLAPNPNKPYRVCDSCYS
KLTKGLETDTNSSTKRGTVVQGFSETNEEELETRSNTQLLRLSSMESFKNMDSRYSKKNK
KFEFNSTRVSPVPNGSSHWSGLNISRSFNPVFGSSKKFFSASVPGSRIVSRATSPVSRRT
SPPRSTTPTPTLGGLTSPRVIANDAKPTNDSLSHEVLNLRSQVENLTRKSHLLEVELERT
TKQLKEAIVIAGEETAKCKAAKEVIKSLTAQLKGMAERLPGGVTKNSKLPPLSGFPMPSE
LSSMATESLGSPSSVGEQISNGPNGLLASNGPSSVRIKAGHPEVGKNGSRLPEAESCHEA
EWVEQDEPGVYITLTALPGGARDLKRVRFSRKRFSETQAEQWWQENRTRCQSNIWTYLKS
EHWASTAVCVDAEDLTTQPASLVLLLLEAGWKMQKKCLSLGVVS
Download sequence
Identical sequences 39946.BGIOSIBCE005015 OsIBCD004532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]