SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD015915 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015915
Domain Number 1 Region: 133-236
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.41e-39
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 820-902
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000719
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015915
Sequence length 926
Comment 926
Sequence
MASSQEKAKTGVLRNAAALLDEMQLMGETQGAKKVINSELWHACAGPLVCLPQRGSLVYY
FPQGHSEQVAATTRKIPNSRIPNYPNLPSQLLCQVHNITLHADKDTDEVYAQMTLQPVNS
ETDVFPIPTLGAYTKSKHPTEYFCKNLTASDTSTHGGFSVPRRAAEKLFPQLDYSMQPPN
QELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFISMHIGVLAAA
AHAASSGSSFTIYYNPRTSPSPFVIPVARYNKATYMQPSVGMRFAMMFETEESSKRRYTG
TVVGISDYDPMRWPNSKWRNLQVEWDEHGYGERPERVSIWDIETPENTLVFPSSTLNSKR
QCLPGYGVSVPGMEIGSANMSSFPRAQGNPYGSLQHIPAVGSELAIMLLNQSGQTLGSPL
SFHQSSYSSIIQNVKQNYIPPLTVSTSACLTKQESLPSDDAQHQFHMANMQNGDLEGSEV
QPVIDSISESKLNATSRDPRNTDSYTSRSTSEQNSKGEPRGKTRRSKKGLPHKTVSEKSD
LSSAPSWICDNQQVGLESKLVGCDEQVNCGNIEDSSGALTQGNFVGQPHGHQVEQKGVLS
PPKVESSKSPDGGKSVNSFPNQGCFSQFIDGLDWMTQPSYYQDSNVIQPAGVSENIFSSS
ADIPPSMIADTMETFQASCLSDCLPNSIQEFISSPDLNSLTFLSPDMQNLEVQLQHDGSN
LPSTSNSFVQMSFSEESASQSANLSGLHMESTHRSINTTSCSQPMSTGGFDAGMYSKLPR
LKESQILSLPEIHTNSMGTSACSMDATEYSLDRSAKPMKPPVRTYTKVQKQGSVGRSIDV
TGFRNYHELRSAIACMFGLQGKLEHPGSSEWKLVYVDYENDVLLVGDDPWEEFINCVRCI
RILSPSEVQQMSENGMHVLNDCIQAA
Download sequence
Identical sequences A3AYC7
39946.BGIOSIBCE016961 OsIBCD015915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]