SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD018777 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD018777
Domain Number 1 Region: 220-606
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-95
Family Regulator of chromosome condensation RCC1 0.00056
Further Details:      
 
Domain Number 2 Region: 13-118
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-25
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 605-672
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.3e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD018777
Sequence length 1038
Comment 1038
Sequence
MASDACSGLHLALITLKKGSKLIKYSRKGKPKIREFRLSSDENTLVWYSHNKEKCLRLSS
VSKVIPGQRTAVFRRFLRPEKDYLSFSLIYKNGQRSLDLVCKDQAEVEVWFSTLESLITS
CRLNFLNDGQTDRVSFSEDVTIYQDSTSYDTTLDIASSITRSFNSAGYSTPNSLNSIRAD
VGSDRVNMLRASTGDNSRVSISSAPSSSSQSSGLDDIESLGDVYVWGEVWTEVLPSEGSS
NYLCSKTDFLIPKPLESDVVLDVQQIACGSRHIGLTTRQGEVFTWGEELGGRLGHGTDTD
ICRPKLVESLAVSNVEYIACGEFHTCVVTASGDLYDWGDGSYNAGLLGHGTGVSHWLPKR
VSGPLEGLQVLSVACGSWHSALTMSSGKLFTFGDGTFGSLGHGDRESVAYPKEVEALSGF
RAMKVACGVWHSAAIVEISGQASTNAMSRKLFTWGDGDKNRLGHGDKEAKLVPTCVQALV
DHNFHQVACGHSMTVALATSGHVFTMGSSNNGQLGNPKADGKQPCMVQDKLGNELVEEIS
CGSNHVAALTSRSEVYTWGMGANGRLGHGSVEDKKKPTLVDALKDRHVKSISCGSNFTTC
ICIHKWVSGADQSVCSGCRQPFGFTRKRHNCYNCGLVHCHACSSRKVLKAALAPTPGKPH
RVCDSCFMKLKAADTGVISSYNKRNVITRRSIDIKDKLERPEIRPSRLATTSPAEPVKYQ
ETKNVRNETKPADPMSMMKASQVPAMLQFKDMAFAGTFGTVPTTVKSMTMGGQMQMGMPM
FSPSPPSKKPSPPPATASPLIGKVDNDGLKKTNELLNQDISKLQSQVNKLKQKCETQDEQ
LQKAERKAKQAASMASEESARRNTVLDFVKHLDSELKVIADRVPGDVADNLKTLQSQSER
FLAGQSSNLVEITGLTGHDIGHHRSSSTGSLPVSQDGSSGNASGSSIAMASDSPCHRIME
NNLKAPGDFAPKYGTHGEVQLIEQFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEE
WWRENQERVFKKYNHPTN
Download sequence
Identical sequences B8AW90
OsIBCD018777 39946.BGIOSIBCE019888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]