SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD019153 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019153
Domain Number 1 Region: 33-133
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-26
Family B3 DNA binding domain 0.0000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019153
Sequence length 254
Comment 254
Sequence
MATIVAWESRNLQLQGGGGGHGGGGGGGGGERREYMFEKVVTPSDVGKLNRLVVPKHYAE
KYFPLGPAARTSPAGTVLCFEDARGGDSTWRFRYSYWSSSQSYVITKGWSRYVRDKRLAA
GDTVSFCRAGARLFIDCRKRAASVSSSSLVPPALIKVQLPPSRPVVDEEEAACGRRHVGR
PPSFHDKAFRKPTQVYHMPTRWVPDQQQAQVVQRWLALLEIWSLILEILALRVFGLRNYT
RDGTTQQMAKIKPY
Download sequence
Identical sequences OsIBCD019153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]