SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD019658 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019658
Domain Number 1 Region: 253-440
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.14e-26
Family cAMP-binding domain 0.0000268
Further Details:      
 
Domain Number 2 Region: 58-246
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000761
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019658
Sequence length 531
Comment 531
Sequence
MELRKQRTVRFHEERAKPTIPTHQKQAGLATSKLGLGISEKNKIFLAGNELWYKKIIDPS
SDFILTWNYVLRIACFVALFMDPLYFYVPKIYYGTPNSCIGRDTRLAIIVTVFRSITDLF
YVLQIIIKFRTAYINPSSTLGVFSRGDLVTDPGNIAKHYLRSSFVVDLVASLPLPQIIIW
SVIPSVKYSLSEHDDDILLLIALFHCYGQTLTVSTYIGETLYAIFLAVLGLVLFAHLIGN
VQTYLQSITARVEEWRIKQRDTEEWMRHRQLPQKLRERVRRFVHYKWLATRGVDEESILK
ALPADLRRDIKRHLCLDLVCRMDGQLLDAICERLVSSLSTVGTYIVREGDPVTEMLFIIR
GKLESSTTDGGRTGFFNSITLKTGDFCGEELLGWALVPKPTVNLPSSTRTVKTIVEVEAF
ALRAEDLKFVASQFRRLHSRKLQHTFRYYSHHWRTWAACFIQAAWRRYKRRRLAKDLSIR
ESFFSRRSFEDDGSPEHSLVLNAVRKGAHIIKELPKFRKPSEPDFSAEHDD
Download sequence
Identical sequences 39946.BGIOSIBCE020930 OsIBCD019658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]