SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD027120 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD027120
Domain Number 1 Region: 89-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-42
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 977-1044
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000221
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD027120
Sequence length 1083
Comment 1083
Sequence
MASSGGGGGGGEEGEGRGATKVNQELWYACAGPLVSLPPQGSLIVYFPQGHSEQADPDTD
EVYARMTLQPVSNVTQCDKETLLASELALKQTRPQTEFFCKTLTASDTSTHGGFSVPRRA
AERIFPRLDFSMQPPAQELQARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLLAG
DSVLFIRDAKQQLLLGIRRANRQPTNLSSSVLSSDSMHIGILAAAAHAAANNSQFTIYYN
PRASTSEFVIPFAKYQKAVYGNQLSLGMRFRMMFETEESGTRRYMGTITGISDLDPVRWK
TSHWRNIQVAWDEAAPTERRTRVSLWEIEPIIAPFFIYPSPLFTAKRPRLPGMTDDETEM
DGLLKRAMPWVGEEICKKDLNIQNSVVPGLNLAQWMNMQHSSSLPGTVVQPELLNSLSGK
PVQNLAAADLSRQISFHPQFLQQNNIQFNTALVPQQNQQTEQLAKVIPTPNQLGSVIIPQ
KVVQDCNSEQRQHVVTQPVQGSQPNINIPQPQLVVQAQLQQPQVILQAQLQQPQVVVQAQ
LQQTQPSVQSHTVLQGGLQQIQLLQQQQPHVQHQQIPQQLHHQQQQTQQLQPVQQVQQSV
QEHQQIKIQPVHVSMDASMNTQVADHQMKLQLLKALQPQQPLISEQQKMLLDLQQQVINS
QSAPQQCVQVTNQAISLHNSNTIQYPTQQKVQSHQVQDLTGNVIPNSKSDIATSMGASSL
HVAGGRQLLKTDDVPSTSTSPSTNSNPVLLQSIPSSSKNQSLTTAGKTSQSSVVLGPTIE
QDTKPYQNVKQTVMIPKTTEQRPATGQDCINNNPQMDYLDTSSSATSVCLSQADGSLQQN
FPPSSFHQHHLLKDTVPDSEFEVTDPRNNLLFGVNIDGQLGLPLNADLLANDIGTDKYMD
QLPGNGISNFISSKDSQQELSSSMISHSFGVADMAFNSIDSAINDTPFLNRNSRSAAGPA
HQRMRTYTKVHKRGAVGRSIDINRYSGYDELKHDVARMFGIEGQLGDQNRVGWKLVYEDH
EKDVLLVGDDPWEDFVKCVRCIRILSPQEEMQMRLVGDFGDSFLPNQACSSSDGGHPWRI
TGD
Download sequence
Identical sequences A0A0D3H288
OBART08G20780.2 OsIBCD027120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]