SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD031888 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031888
Domain Number 1 Region: 35-130
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-29
Family B3 DNA binding domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031888
Sequence length 363
Comment 363
Sequence
MAMNHPLFSQEQPQSWPWGVAMYANFHYHHHYEKEHMFEKPLTPSDVGKLNRLVIPKQHA
ERYFPLGAGDAADKGLILSFEDEAGAPWRFRYSYWTSSQSYVLTKGWSRYVKEKRLDAGD
VVHFERVRGSFGVGDRLFIGCRRRGDAAAAQTPAPPPAVRVAPAAQNAGEQQPWSPMCYS
TSGGGSYPTSPANSYAYRRAADHDHGDMHHADESPRDTDSPSFSAGSAPSRRLRLFGVNL
DCGPEPEADTTAAATMYGYMHQQSSYAAMSAVPSYWLFSSSSWLPETLLTVWAPGSRHGW
GGFRKHQVEKERGIEETGRELYVCQYVSSVCIVGPRTNPEADVSTPASSGNITLSPFHLF
YCA
Download sequence
Identical sequences B8BJ68
39946.BGIOSIBCE033550 OsIBCD031888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]