SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD034096 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034096
Domain Number 1 Region: 33-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-30
Family B3 DNA binding domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034096
Sequence length 309
Comment 309
Sequence
MAMHPLAQGHPQAWPWGVAMYTNLHYHHHYEREHLFEKPLTPSDVGKLNRLVIPKQHAER
YFPLGGGDSGEKGLLLSFEDESGKPWRFRYSYWTSSQSYVLTKGWSRYVKEKRLDAGDVV
HFERVRGLGAADRLFIGCRRRGESAPAPPPAVRVTPQPPALNGGEQQPWSPMCYSTSGSS
YDPTSPANSYAYHRSVDQDHSDILHAGESQREADAKSSSAASAPPPSRRLRLFGVNLDCG
PEPEADQATAMYGYMHHQSPYAAVSTVPNYWSGQLVDEMMRRSEAFACRILTTNSETSYY
YHQPTTTTL
Download sequence
Identical sequences 39946.BGIOSIBCE035803 OsIBCD034096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]