SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD037717 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037717
Domain Number 1 Region: 27-126
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-18
Family B3 DNA binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037717
Sequence length 267
Comment 267
Sequence
MAASLPLSAAIVGAEESVDKEVLEMEYLFEKFLMPSDLCSNTEWLGIPEEHVRKFGMMLE
DRDGYSVIFFQDGVVPGKLWCFRYWKSNGVHGLTKGWRCFVREKGLKAGDTISFFRGSAC
GRLFICCRLGTRATFASSSTLHHGFSMPPPPARPLVGLESGMLARDVPSLGQARLHDGNQ
DGGGAPSRHVPSLGRRVEAQLSRVSSRRKRRTMKHSIPEPTIETPPILESMFLIAAPPAV
KCLRLFGVNIYVLPVSSSGQPKQESSP
Download sequence
Identical sequences A2X4H1
39946.BGIOSIBCE006863 OsIBCD037717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]