SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD037718 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037718
Domain Number 1 Region: 27-131
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-19
Family B3 DNA binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037718
Sequence length 271
Comment 271
Sequence
MAASPPLPTSIDGGQVLDDMEVVEMKYLFGKVLMPSDVSWDTEQLVIPDEHVGKLLDMVV
MNRPEGGFFVVVVEDGEVTGKLWLFRYWKRDDVHCLTKGWGCYAREKGLRAGDTVSFHST
ACGRFFICCRCTCMSFLSLPTTSHRIHGSSVLPQPRAAQAAHHPFSGHATLCLGNKASDH
SAPARHATASLGCAAAQPPQVPPTPTPRRRRRSMMVHPEPPEHTTDGMPVILESMALVST
PPVAKRVRLFGVYIDVPPLRPGGEATQDFNP
Download sequence
Identical sequences A2X4H2
39946.BGIOSIBCE006864 OsIBCD037718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]