SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD038424 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD038424
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-29
Family B3 DNA binding domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD038424
Sequence length 308
Comment 308
Sequence
MEFITPIVRPASAAAGGGEVQESGGRSLAAVEKEHMFDKVVTPSDVGKLNRLVIPKQHAE
KYFPLDAASNEKGLLLSFEDRTGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDTV
SFGRGVGEAARGRLFIDWRRRPDVVAALQPPTHRFAHHLPSSIPFAPWAHHHGHGAAAAA
AGARFLLPPSSTPIYDHHRRHAHAVGYDAYAAATSRQVLFYRPLPPQQQHHPAVVLESVP
VRMTAGHAEPPSAPSKRVRLFGVNLDCANSEQDHAGVVRKTAPPPLPSPPSSSSSSSGKA
RCSLNLDL
Download sequence
Identical sequences A0A0E0GBA1 A2XBV3
39946.BGIOSIBCE009434 ONIVA02G30750.1 OsIBCD038424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]