SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD045517 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD045517
Domain Number 1 Region: 32-136
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-28
Family B3 DNA binding domain 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD045517
Sequence length 312
Comment 312
Sequence
MEFTPISPPTRVAGGEEDSERGAAAWAVVEKEHMFEKVVTPSDVGKLNRLVIPKQHAERY
FPLDAAAGAGGGGGGGGGGGGGKGLVLSFEDRTGKAWRFRYSYWNSSQSYVMTKGWSRFV
KEKRLGAGDTVSFGRGLGDAARGRLFIDFRRRRQDAGSFMFPPTAAPPSHSHHHHQRHHP
PLPSVPLCPWRDYTTAYGGGYGYGYGGGSTPASSRHVLFLRPQVPAAVVLKSVPVHVAAA
SAVQEAATTTRPKRVRLFGVNLDCPAAMDDDDDIAGAASRTAALSLLQLPSPSSSTSSST
AGKKMCSLDLGL
Download sequence
Identical sequences A0A0E0IVJ0 A2Z9R3
39946.BGIOSIBCE032901 OsIBCD045517 ONIVA10G18740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]