SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000058 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000000058
Domain Number - Region: 223-256
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00523
Family Moesin tail domain 0.013
Further Details:      
 
Domain Number - Region: 123-199
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0165
Family NadC C-terminal domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000058   Gene: ENSPPYG00000000061   Transcript: ENSPPYT00000000065
Sequence length 713
Comment pep:known_by_projection chromosome:PPYG2:1:5734609:5981303:-1 gene:ENSPPYG00000000061 transcript:ENSPPYT00000000065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSPENSTLEEILGQYQRSLRERASRSIHQLKCALKEGDVTIGEDAPNLSFSTSVGNKD
ARTAWPELQQSHAVNQLKDLLRQQADKESEVSPSRRRKMSPLRSLEHEETNMPTMHDLVH
IIYDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLENERLQQELKSQRQEETLREQTVLE
ASGNMQNSWITTGEDSGVGETSKRPFSHDNADIGKAASAGEQLELEKLKLTYEEKCEIQE
SQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNV
HMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQ
CDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEA
QVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRA
KTNRDLEIKDQEIEKLRIELGESKQHLEQEQQKAARAREECLRLTELLGESEHQLHLTRQ
EKDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLK
EECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHETMK
QRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDRLRTQLPSMPQSDC
Download sequence
Identical sequences H2N391
9600.ENSPPYP00000000058 XP_002809289.1.23681 ENSPPYP00000000058 ENSPPYP00000000058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]