SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000150 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000150
Domain Number 1 Region: 49-294
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.39e-79
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000150   Gene: ENSPPYG00000000152   Transcript: ENSPPYT00000000163
Sequence length 326
Comment pep:known_by_projection chromosome:PPYG2:1:21743114:21773391:-1 gene:ENSPPYG00000000152 transcript:ENSPPYT00000000163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPASGMGPLGRSALGLLLLLLVVPPRRVAASVHRHPENQGISPTGSVACGRPSMEGKI
LGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFPRDKNIKIYDMYVGLVNL
RVASNHTQWYEVNRVILHPTYEVYHPIGGDVALVQLKTRIVFSDSVLPVCLATPEVNLTS
ANCWATGWGLVSQQGETSDELQEVQLPLIPEPWCHLLYGHMSYIMPDMLCAGDILNVKTV
CEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWICYNIEITPTPAQ
PAPALSPALGATLSILVAMLAGWSVL
Download sequence
Identical sequences H2N3H9
ENSPPYP00000000150 ENSPPYP00000000150 9600.ENSPPYP00000000150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]