SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000612 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000612
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-32
Family C-type lectin domain 0.000000623
Further Details:      
 
Domain Number 2 Region: 242-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 302-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000103
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 366-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 180-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 6 Region: 482-546
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000639
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 7 Region: 423-482
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000681
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000612   Gene: ENSPPYG00000000528   Transcript: ENSPPYT00000000637
Sequence length 601
Comment pep:known_by_projection chromosome:PPYG2:1:81420296:81430023:1 gene:ENSPPYG00000000528 transcript:ENSPPYT00000000637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFLSALTLVLLVKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSVSCDRGYLPSILYIMQCMSSGEWSAPVPACNVV
ECDAVTNPANGFVQCFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPMCK
AVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WVKCSSLAVPGKINMSCIGEPVFGTVCKFACPEGWMLNGSAALTCGATGHWSGMLPTCEA
PTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCFRKAKKFVPASSCQSLESDGSYQKPSYI
L
Download sequence
Identical sequences H2N4S3
9600.ENSPPYP00000000612 ENSPPYP00000000612 ENSPPYP00000000612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]