SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000616 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000616
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily C-type lectin-like 9.97e-29
Family C-type lectin domain 0.000000241
Further Details:      
 
Domain Number 2 Region: 261-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 316-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.48e-16
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 564-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 502-568
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 440-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000389
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 199-266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000598
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 8 Region: 377-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 641-704
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 696-761
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000131
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 11 Region: 161-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000616   Gene: ENSPPYG00000000530   Transcript: ENSPPYT00000000641
Sequence length 829
Comment pep:known_by_projection chromosome:PPYG2:1:81542144:81573194:1 gene:ENSPPYG00000000530 transcript:ENSPPYT00000000641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASCQKAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYCQ
NRYTDLVAIQNKNEIDYLNKILPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNE
PNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNY
TCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFYCTDGYQVNGPSK
LECLASGIWTNKPPQCLAAQCPHLKIPEQGNMTCLHSAKAFQHQSSCSFSCEEGFALVGP
EVVQCTASGVWTAPAPVCKAVQCQHLEAPNEGIMDCVHPLTAFAYGSSCKFECQPGYRVR
GLDMLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFV
LRGADIVRCDNLGQWTAPAPVCQALQCQDIPVPKEAQVNCSHPFGAFRYQSVCSFTCNEG
LLLVGASVLQCLDTGNWDSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFTCD
EGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTRGEFNVGSACHFS
CNKGFKLEGPNNVECTTSGRWSATPPTCKGIASLPSPGVQCPALTTPGQGTMYCRHHPGI
FGFNTTCYFGCNAGFILIGDSTLSCRPSGQWTAVTPACRAVKCLELHVNKPIAMNCSNLW
GNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTMPTCQAGPLTIQEVLTYFGGAVAS
TTGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences H2N4S7
ENSPPYP00000000616 ENSPPYP00000000616 9600.ENSPPYP00000000616 XP_009239435.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]