SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000647 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000647
Domain Number 1 Region: 125-214
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000000951
Family Dual specificity phosphatase-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000647   Gene: ENSPPYG00000000553   Transcript: ENSPPYT00000000672
Sequence length 234
Comment pep:known_by_projection chromosome:PPYG2:1:84095295:84133310:-1 gene:ENSPPYG00000000553 transcript:ENSPPYT00000000672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSKDPEEEQVVPSEEDEANVRAVQAHYLRSPSPSQYSMVSDAETESIFMEPIHLSSAI
AAKQIINEELKPRGVRADAECPGMLESAEQLLVEDLYNRVREKMDDTSLYNTPCVLDLQR
ALVQDRQEAPWNEVDEVWPNVFIAEKSVAVNKGRLKRLGITHILNAAHGTGVYTGPEFYT
GLEIQYLGVEVDDFPEVDISQHFRKAAEFLDEALLTYRGERGLPAPGCWNSTGG
Download sequence
Identical sequences H2N4V8
ENSPPYP00000000647 ENSPPYP00000000647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]