SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000664 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000664
Domain Number 1 Region: 30-514
Classification Level Classification E-value
Superfamily ALDH-like 6.81e-170
Family ALDH-like 0.00000000000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000664   Gene: ENSPPYG00000000568   Transcript: ENSPPYT00000000690
Sequence length 518
Comment pep:known chromosome:PPYG2:1:85547389:85585244:1 gene:ENSPPYG00000000568 transcript:ENSPPYT00000000690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLRAGLAALFPLLRSLRPSSVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREGEIATMEC
INNGKSIFEARLDINISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYTEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
Download sequence
Identical sequences H2N4X7
ENSPPYP00000000664 ENSPPYP00000000664 9600.ENSPPYP00000000664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]