SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000821 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000821
Domain Number 1 Region: 147-253
Classification Level Classification E-value
Superfamily C-type lectin-like 1.62e-37
Family Link domain 0.0012
Further Details:      
 
Domain Number 2 Region: 255-338
Classification Level Classification E-value
Superfamily C-type lectin-like 1.81e-23
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 43-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000156
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000821   Gene: ENSPPYG00000000710   Transcript: ENSPPYT00000000852
Sequence length 340
Comment pep:known_by_projection chromosome:PPYG2:1:94881669:94888764:-1 gene:ENSPPYG00000000710 transcript:ENSPPYT00000000852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWLTLSTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLG
TTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRL
EDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATY
SQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFC
FTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSV
RFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN
Download sequence
Identical sequences H2N5C5
ENSPPYP00000000821 XP_002810065.1.23681 XP_009241226.1.23681 ENSPPYP00000000821 9600.ENSPPYP00000000821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]