SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000994 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000994
Domain Number 1 Region: 38-237
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.7e-32
Family PaaI/YdiI-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000994   Gene: ENSPPYG00000000852   Transcript: ENSPPYT00000001027
Sequence length 247
Comment pep:known_by_projection chromosome:PPYG2:1:99727794:99733997:1 gene:ENSPPYG00000000852 transcript:ENSPPYT00000001027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRRGFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKEFALPNA
SWCSDMLSLYQEFLEKTKSSSWIKLPSFKSNRDHIQRLKLPSGLAVSSNKGDCRIFTRCI
QVEGQGFEYVIFFQPSQKKSVCLFRPGPYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEG
LFTLSLNIRFKNLIPVGSLVVMDVEVDKIEDQKLYMSCIAHSRDQQTVYAKSSSVFLQLQ
LEEESPQ
Download sequence
Identical sequences H2N5T9
ENSPPYP00000000994 ENSPPYP00000000994 9600.ENSPPYP00000000994 XP_002810253.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]