SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001023 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001023
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000249
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001023   Gene: ENSPPYG00000000875   Transcript: ENSPPYT00000001057
Sequence length 227
Comment pep:known_by_projection chromosome:PPYG2:1:100435201:100440052:1 gene:ENSPPYG00000000875 transcript:ENSPPYT00000001057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVHPSNNEVWPHL
TEGKKQETGAGRANGEVLPTPGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGE
NGVPGEEAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences H2N5W7
9600.ENSPPYP00000001023 ENSPPYP00000001023 ENSPPYP00000001023 XP_009242829.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]