SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001037 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001037
Domain Number 1 Region: 362-464
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 173-227,254-269,297-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 570-734
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000000000483
Family Tetraviridae-like VP 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001037   Gene: ENSPPYG00000000888   Transcript: ENSPPYT00000001071
Sequence length 789
Comment pep:known chromosome:PPYG2:1:100730200:100798309:1 gene:ENSPPYG00000000888 transcript:ENSPPYT00000001071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTANPEMTSDVPSLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDEDQISNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNVEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGAAPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTSSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
Download sequence
Identical sequences H2N5Y0
ENSPPYP00000001037 ENSPPYP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]