SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001059 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001059
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.06e-90
Family Carbonic anhydrase 0.00000000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001059   Gene: ENSPPYG00000000906   Transcript: ENSPPYT00000001094
Sequence length 337
Comment pep:known_by_projection chromosome:PPYG2:1:101359962:101366955:-1 gene:ENSPPYG00000000906 transcript:ENSPPYT00000001094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDLPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPEG
SEHQINSEATVAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPPQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLIQNYRAPQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRXXXXXXXXXVGFTSAQATTEA
Download sequence
Identical sequences H2N602
ENSPPYP00000001059 ENSPPYP00000001059 9600.ENSPPYP00000001059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]