SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001118 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001118
Domain Number 1 Region: 27-158
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-36
Family C-type lectin domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001118   Gene: ENSPPYG00000000960   Transcript: ENSPPYT00000001155
Sequence length 158
Comment pep:known_by_projection chromosome:PPYG2:1:108235192:108249475:1 gene:ENSPPYG00000000960 transcript:ENSPPYT00000001155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLASIRSLKEASTIAEYISGYQRSQPIWIGLHDRRQRQQWQWIDGAMYLYRSWSG
KSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Download sequence
Identical sequences H2N658
ENSPPYP00000001118 9600.ENSPPYP00000001118 ENSPPYP00000001118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]