SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001486 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001486
Domain Number 1 Region: 468-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.66e-76
Family Protein kinases, catalytic subunit 0.000000285
Further Details:      
 
Domain Number 2 Region: 312-395
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 63-155
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-21
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001486
Domain Number - Region: 171-258
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00275
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001486   Gene: ENSPPYG00000001274   Transcript: ENSPPYT00000001533
Sequence length 938
Comment pep:known_by_projection chromosome:PPYG2:1:165210989:165640272:-1 gene:ENSPPYG00000001274 transcript:ENSPPYT00000001533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRPRRRGTRPPLLALLAALLLAAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLT
LDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIR
NLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACA
RFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETS
SVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRI
GIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGH
SYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIA
LLFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEEL
GECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLL
GAVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQI
AAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWM
PPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPP
RMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVS
NLSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPT
GPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGI
TVFGNKSQKPYKIDSKQASLLGDANIHGHTESMISAEL
Download sequence
Identical sequences H2N760
ENSPPYP00000001486 9600.ENSPPYP00000001486 ENSPPYP00000001486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]