SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001641 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001641
Domain Number 1 Region: 78-240
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.71e-37
Family Mismatch glycosylase 0.0000611
Further Details:      
 
Domain Number 2 Region: 289-428
Classification Level Classification E-value
Superfamily Nudix 9.38e-30
Family MutY C-terminal domain-like 0.000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001641   Gene: ENSPPYG00000001415   Transcript: ENSPPYT00000001696
Sequence length 479
Comment pep:known_by_projection chromosome:PPYG2:1:184576597:184590534:1 gene:ENSPPYG00000001415 transcript:ENSPPYT00000001696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLVSRLSRQRAIMRKPRAAVGSGHRKQAASQEGRQKRAKNNSQAKPSACDAGLARQPE
EVVLQASVSSYHVFRDLAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEVDLDRRAYAVWVS
EVMLQQTQVATVINYYTGWMKKWPTLQDLPSASLEVNQLWAGLGYYSRNVARVLCRVRAI
GADPNSTVSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCRARQ
RVERERLLASRSLSSSPDVEECAANTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREE
SSATCVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGP
LPATRLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAM
KKVFRVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDGHSLNSAAQ
Download sequence
Identical sequences H2N7L3
9600.ENSPPYP00000001641 ENSPPYP00000001641 ENSPPYP00000001641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]