SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001644 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001644
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 6.1e-118
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001644   Gene: ENSPPYG00000001419   Transcript: ENSPPYT00000001700
Sequence length 367
Comment pep:known chromosome:PPYG2:1:184904342:184907850:-1 gene:ENSPPYG00000001419 transcript:ENSPPYT00000001700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLEC
LRDPEVVASELDYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALVPYLVGQVAAGAQALQLFESHAGHLGPQLFSKFALPYIRDV
AKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVT
LQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
Download sequence
Identical sequences H2N7L6
ENSPPYP00000001644 9600.ENSPPYP00000001644 ENSPPYP00000001644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]