SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001771 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001771
Domain Number 1 Region: 31-413
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-67
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Domain Number 2 Region: 434-547,666-697
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-37
Family Phosphate binding protein-like 0.00000105
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000001771
Domain Number - Region: 567-661
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000706
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001771   Gene: ENSPPYG00000001535   Transcript: ENSPPYT00000001828
Sequence length 709
Comment pep:known_by_projection chromosome:PPYG2:1:193138644:193359386:1 gene:ENSPPYG00000001535 transcript:ENSPPYT00000001828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPWRRLRSLVWEYWAGLLVCAFWIPDSRGMPHVIRIGGIFEYADGPNAQVMNAEEHAF
RFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQGALGVVAIFGPSQGSCTNA
VQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQYLKWRSATVVYD
DSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQ
ILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWS
MERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHRHKAWRFGG
RFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISLKEDGLEKVGVWSPADGLNITEVA
KGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFS
YEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGV
SILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPG
SEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAF
LTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKVRPSPSYCSTMS
Download sequence
Identical sequences H2N7Y8
ENSPPYP00000001771 ENSPPYP00000001771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]