SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000001948 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000001948
Domain Number 1 Region: 124-299
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.52e-57
Family Crystallins/Ca-binding development proteins 0.0000703
Further Details:      
 
Domain Number 2 Region: 312-480
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 8.19e-46
Family Crystallins/Ca-binding development proteins 0.0005
Further Details:      
 
Domain Number 3 Region: 12-111
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.3e-21
Family Crystallins/Ca-binding development proteins 0.0019
Further Details:      
 
Domain Number 4 Region: 484-614
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.02e-19
Family Ricin B-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000001948   Gene: ENSPPYG00000001686   Transcript: ENSPPYT00000002009
Sequence length 616
Comment pep:known_by_projection chromosome:PPYG2:1:204034102:204054079:1 gene:ENSPPYG00000001686 transcript:ENSPPYT00000002009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VELRTPGTKWSPQGIGSLRRVVWDYSTPEISLFSEEGLKGEQVKLTEALKNSQGLEKPLQ
VASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRLGCPSVEKP
GEPRAVVYEAPGFQGRSWEVSRDIYNLQQPEDSQSPHLASVGSLRVLGGCWVGYEKEGFR
GHQYLLEEGEYPDWSHWGGYDELLTSLRVIRTDFGDPAVVLFEAMDFEGHGVEVSKALPD
VELVQHGPSTQAIHVLSGVWVAYQEVGFSGEQYVLEKGVYRNCEDWGAGNSALASLQPVL
QVGEHDLHFVSKIQLFSRPDFLGEHFSFEDDQVALPASFRPQSCRVHGGSWILFDEKNFE
GDQHILSEGEFPTLTAMGCLASTVLGSLQKVSLHFSEPSIFLYGLECFEGKEIELSREVR
SLQAEGFNNHVLSVRIKGGVWVLCEHSDFRGRQWLVGSCEITNWLTYSGTQRVGSLYPIK
QRRVYFRLWNAALGGFLAVPDHVEDMKAGRVVVSDPRAGGSCIWYYEDGMLKNQMAPTMS
LQVIGPPSSGSKVVLWAESRLPRQTWSISESGHICSQMFEGQILDVKGGRGYDRDHVVLW
EPDEDRASQIWTIHVL
Download sequence
Identical sequences H2N8F9
ENSPPYP00000001948 ENSPPYP00000001948 9600.ENSPPYP00000001948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]