SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002032 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002032
Domain Number 1 Region: 41-308
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-79
Family Eukaryotic proteases 0.0000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002032   Gene: ENSPPYG00000001756   Transcript: ENSPPYT00000002094
Sequence length 310
Comment pep:known_by_projection chromosome:PPYG2:1:208440485:208478449:-1 gene:ENSPPYG00000001756 transcript:ENSPPYT00000002094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPGVPPPVGLGVGPNQPPLTFCPILEPQALCPFPIISKLMMLRLLSSLLLVAVASGYGP
PSSRPSSRVVNGEDAVPYSWPWQVSLQYENSGSFHHTCGGSLIAPDWVVTAGHCISSSRI
YQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNPKCVACGNDIALIKLSRSAQLGDAVQ
LASLPPAGDILPNETPCYITGWGRLCTNGPLPDKLQQALLPVVDYEHCSKWNWWGSSVKK
TMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSSLGCNTIRKPTVFTRISAFI
DWIEETIASH
Download sequence
Identical sequences H2N8P3
ENSPPYP00000002032 9600.ENSPPYP00000002032 ENSPPYP00000002033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]