SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000002072 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000002072
Domain Number 1 Region: 2-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-99
Family Capz beta-1 subunit 0.000000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000002072   Gene: ENSPPYG00000001789   Transcript: ENSPPYT00000002134
Sequence length 277
Comment pep:known chromosome:PPYG2:1:210862365:211007895:1 gene:ENSPPYG00000001789 transcript:ENSPPYT00000002134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN
Download sequence
Identical sequences G3QN07 H2N8T0 H2R9E0 P47756
ENSPPYP00000002072 NP_001193469.1.87134 NP_001193469.1.92137 XP_003949357.1.37143 XP_004024836.1.27298 XP_004592362.1.84141 XP_006866382.1.41390 XP_007933836.1.48129 XP_008587820.1.73410 gi|330864679|ref|NP_001193469.1| ENSP00000364284 HR33 ENSP00000264202 ENSP00000364284 ENSPPYP00000002072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]